PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G109500.4
Common NameB456_007G109500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 600aa    MW: 66656 Da    PI: 7.3335
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G109500.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B368.68.5e-22129230198
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f k+lt sd++++g +++ +k+a+e+      ++ ++ +++l+ +d++g +W++k+i+  ++++r++lt+GW+ Fv +++L +gD +vF  
  Gorai.007G109500.4 129 FSKILTASDTSTHGGFSVLRKHATEClppldmNLATP-TQELVAKDLHGYEWRFKHIFrGRQPRRHLLTTGWSTFVTSKRLVAGDAFVFL- 217
                         889***************************9744444.459****************97778888*************************. PP

                         -SSSEE..EEEEE- CS
                  B3  85 dgrsefelvvkvfr 98 
                          + +++el+v+v+r
  Gorai.007G109500.4 218 -RGDNGELRVGVRR 230
                         .3489999****98 PP

2Auxin_resp1064.3e-35256335183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aaha++t++ F v+Y+Pr+  s+F++ v+k+++a+++ +svGmRfkm+fe+eds+err++Gt+vgv d++p +W++SkWrsLk
  Gorai.007G109500.4 256 AAHAVTTHTLFVVYYKPRT--SQFIIGVNKYLEAINNGFSVGMRFKMRFEGEDSPERRFTGTIVGVGDISP-HWSESKWRSLK 335
                         79****************6..9***********************************************99.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.05E-38114259IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.9E-39120245IPR015300DNA-binding pseudobarrel domain
CDDcd100173.21E-19127230No hitNo description
SMARTSM010193.8E-21129232IPR003340B3 DNA binding domain
PROSITE profilePS5086312.21129232IPR003340B3 DNA binding domain
PfamPF023629.8E-20129230IPR003340B3 DNA binding domain
PfamPF065072.5E-32256335IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MAHLEGNQRG SSTAHAVSGS AGDDLYQELW KLCAGPLVEV PRVHERVFYF PQGHMEQLEA  60
STNQELSNQT PLFNLPSKIL CRVLHVELLA EQETDEVYAQ ITLQPEDQSE PTSLDPFPTE  120
APKRKVHSFS KILTASDTST HGGFSVLRKH ATECLPPLDM NLATPTQELV AKDLHGYEWR  180
FKHIFRGRQP RRHLLTTGWS TFVTSKRLVA GDAFVFLRGD NGELRVGVRR LARQQSTMPS  240
SVISSQSMHL GVLATAAHAV TTHTLFVVYY KPRTSQFIIG VNKYLEAINN GFSVGMRFKM  300
RFEGEDSPER RFTGTIVGVG DISPHWSESK WRSLKIQWDE PAAIQRPERV SPWEIEPFVA  360
SASTNAQPTI MCKRPRPVDI PASEITTSSA GSAFWCRESI QSHELTPVGS TLEVQSSENQ  420
VMWPMRQKEA DNCLINGNGG YKSRTPPENA WPPSPLVNVS LNLFPDSMEN NYKTGALQTA  480
LTGYAKGLMH DQVEKRKTET FTGCRLFGFN LTDSTSVAAP PDKEQTSTSI DYNGVRGHVP  540
AAFHVEQKPE TSKEQKQVAS ETSTQEMQAK QGSATSMRSR TKVNFTVSAS LDCIHYSSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldx_A1e-1681935813355Auxin response factor 1
4ldx_B1e-1681935813355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1372376KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5670008e-39AJ567000.1 Gossypium hirsutum microsatellite DNA mGhCIR051, clone CIR051.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490132.10.0PREDICTED: auxin response factor 18-like isoform X2
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A0D2QQN70.0A0A0D2QQN7_G
STRINGPOPTR_0014s09560.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]